Lineage for d1gotg_ (1got G:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51411Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (8 superfamilies)
  4. 51433Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
  5. 51434Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 51435Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 51436Species Cow (Bos taurus) [TaxId:9913] [48673] (8 PDB entries)
  8. 51447Domain d1gotg_: 1got G: [19629]
    Other proteins in same PDB: d1gota1, d1gota2, d1gotb_

Details for d1gotg_

PDB Entry: 1got (more details), 2 Å

PDB Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits

SCOP Domain Sequences for d1gotg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gotg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)}
ltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfke

SCOP Domain Coordinates for d1gotg_:

Click to download the PDB-style file with coordinates for d1gotg_.
(The format of our PDB-style files is described here.)

Timeline for d1gotg_: