Lineage for d3asox_ (3aso X:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578296Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 2578297Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 2578335Protein automated matches [190272] (1 species)
    not a true protein
  7. 2578336Species Cow (Bos taurus) [TaxId:9913] [187064] (25 PDB entries)
  8. 2578357Domain d3asox_: 3aso X: [196283]
    Other proteins in same PDB: d3asoa_, d3asob1, d3asob2, d3asoc_, d3asod_, d3asoe_, d3asof_, d3asog_, d3asoh_, d3asoi_, d3asoj_, d3asok_, d3asol_, d3asom_, d3ason_, d3asoo1, d3asoo2, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asou_, d3asov_, d3asow_, d3asoy_, d3asoz_
    automated match to d1v54k_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asox_

PDB Entry: 3aso (more details), 2.3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
PDB Compounds: (X:) Cytochrome c oxidase subunit 7B

SCOPe Domain Sequences for d3asox_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asox_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d3asox_:

Click to download the PDB-style file with coordinates for d3asox_.
(The format of our PDB-style files is described here.)

Timeline for d3asox_: