SCOPe 2.02: Domain d3s8fa_: 3s8f A:

Lineage for d3s8fa_ (3s8f A:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein automated matches [190134] (4 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [189878] (9 PDB entries)

8. Domain d3s8fa_: 3s8f A: [196274]
   Other proteins in same PDB: d3s8fc_
   automated match to d1xmea_
   complexed with cu, cua, has, hem, olc, per

Details for d3s8fa_

PDB Entry: 3s8f, 1.8 Å

PDB Description: 1.8 a structure of ba3 cytochrome c oxidase from thermus thermophilus in lipid environment

PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3s8fa_:

Sequence; same for both SEQRES and ATOM records:

>d3s8fa_ f.24.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllane
atvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiy
tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
lfghlnpvpgwrlw

Timeline for d3s8fa_:

• d3s8fa_ is new in SCOPe 2.02-stable
  
• d3s8fa_ appears in SCOPe 2.03
  
• d3s8fa_ appears in the current release, SCOPe 2.08