Lineage for d3s8ga_ (3s8g A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579534Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2579535Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2579536Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2579554Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)
  7. 2579555Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries)
  8. 2579557Domain d3s8ga_: 3s8g A: [196273]
    Other proteins in same PDB: d3s8gb1, d3s8gb2, d3s8gc_
    automated match to d1xmea_
    complexed with cu, cua, has, hem, olc, per; mutant

Details for d3s8ga_

PDB Entry: 3s8g (more details), 1.8 Å

PDB Description: 1.8 a structure of ba3 cytochrome c oxidase mutant (a120f) from thermus thermophilus in lipid environment
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3s8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s8ga_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvfalpllane
atvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiy
tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
lfghlnpvpgwrlw

SCOPe Domain Coordinates for d3s8ga_:

Click to download the PDB-style file with coordinates for d3s8ga_.
(The format of our PDB-style files is described here.)

Timeline for d3s8ga_: