Lineage for d1g72b_ (1g72 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346747Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 2346748Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 2346749Protein Methanol dehydrogenase, light chain [48668] (3 species)
  7. 2346759Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (6 PDB entries)
  8. 2346766Domain d1g72b_: 1g72 B: [19627]
    Other proteins in same PDB: d1g72a_, d1g72c_
    complexed with ca, pqq

Details for d1g72b_

PDB Entry: 1g72 (more details), 1.9 Å

PDB Description: catalytic mechanism of quinoprotein methanol dehydrogenase: a theoretical and x-ray crystallographic investigation
PDB Compounds: (B:) methanol dehydrogenase light subunit

SCOPe Domain Sequences for d1g72b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g72b_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian

SCOPe Domain Coordinates for d1g72b_:

Click to download the PDB-style file with coordinates for d1g72b_.
(The format of our PDB-style files is described here.)

Timeline for d1g72b_: