Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
Protein automated matches [190030] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187366] (2 PDB entries) |
Domain d2y9ua_: 2y9u A: [196257] automated match to d1rg6a_ complexed with so4; mutant |
PDB Entry: 2y9u (more details), 1.6 Å
SCOPe Domain Sequences for d2y9ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y9ua_ a.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tdcsivsflarlgcsscldyfttqglttiyqiehysmddlaslkipeqfrhaiwkgildh rqlhefs
Timeline for d2y9ua_: