SCOPe 2.08: Domain d2xmfa1: 2xmf A:0-54

Lineage for d2xmfa1 (2xmf A:0-54)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)

8. Domain d2xmfa1: 2xmf A:0-54 [196242]
   Other proteins in same PDB: d2xmfa2
   automated match to d2drka_
   complexed with dia

Details for d2xmfa1

PDB Entry: 2xmf, 1.5 Å

PDB Description: myosin 1e sh3

PDB Compounds: (A:) myosin 1e sh3

SCOPe Domain Sequences for d2xmfa1:

Sequence; same for both SEQRES and ATOM records:

>d2xmfa1 b.34.2.0 (A:0-54) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pqckalyaydaqdtdelsfnandiidiikedpsgwwtgrlrgkqglfpnnyvtki

Timeline for d2xmfa1:

• d2xmfa1 first appeared in SCOPe 2.02, called d2xmfa_
  
• d2xmfa1 appears in SCOPe 2.07