SCOPe 2.04: Domain d3tgda_: 3tgd A:

Lineage for d3tgda_ (3tgd A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (29 PDB entries)

8. Domain d3tgda_: 3tgd A: [196186]
   automated match to d2clwa_

Details for d3tgda_

PDB Entry: 3tgd, 1.8 Å

PDB Description: Crystal structure of the human ubiquitin-conjugating enzyme (E2) UbcH5b

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d3tgda_:

Sequence; same for both SEQRES and ATOM records:

>d3tgda_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltih
fptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnp
ddplvpeiariyktdrekynriarewtqkyam

Timeline for d3tgda_:

• d3tgda_ first appeared in SCOPe 2.02
  
• d3tgda_ appears in SCOPe 2.03
  
• d3tgda_ appears in SCOPe 2.05
  
• d3tgda_ appears in the current release, SCOPe 2.08, called d3tgda1