Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) automatically mapped to Pfam PF00121 |
Protein automated matches [196175] (9 species) not a true protein |
Species Rhipicephalus microplus [TaxId:6941] [196184] (1 PDB entry) |
Domain d3th6b_: 3th6 B: [196185] automated match to d2i9eb_ |
PDB Entry: 3th6 (more details), 2.4 Å
SCOPe Domain Sequences for d3th6b_:
Sequence, based on SEQRES records: (download)
>d3th6b_ c.1.1.1 (B:) automated matches {Rhipicephalus microplus [TaxId: 6941]} arrfcvggnwkmhgsknsirdicntlkgasldpnvevivacpapyldycrsllppsvala aqncykveqgaftgeispgmikdcggqwvilghserrhvfkeddvligekikhalesgln viacigelledreagrteevcfrqikhiasnvkdwskvviayepvwaigtgktatpdqaq evhskvrnwlstnvsadvaskvriqyggsvnagnckelgrkpdidgflvggaslkpefvq iinamq
>d3th6b_ c.1.1.1 (B:) automated matches {Rhipicephalus microplus [TaxId: 6941]} arrfcvggnwkmhgsknsirdicntlkgasldpnvevivacpapyldycrsllppsvala aqncykveqgaftgeispgmikdcggqwvilghserrhvfkeddvligekikhalesgln viacigelledreagrteevcfrqikhiasnvkdwskvviayepvwaiatpdqaqevhsk vrnwlstnvsadvaskvriqyggsvnagnckelgrkpdidgflvggaslkpefvqiinam q
Timeline for d3th6b_: