Lineage for d3o5wa_ (3o5w A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000177Species European mistletoe (Viscum album) [TaxId:3972] [188629] (7 PDB entries)
  8. 3000183Domain d3o5wa_: 3o5w A: [196178]
    Other proteins in same PDB: d3o5wb1, d3o5wb2
    automated match to d1sz6a_
    complexed with gol, h35, nag, so4

Details for d3o5wa_

PDB Entry: 3o5w (more details), 2.7 Å

PDB Description: binding of kinetin in the active site of mistletoe lectin i
PDB Compounds: (A:) Beta-galactoside-specific lectin 1 chain A isoform 1

SCOPe Domain Sequences for d3o5wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o5wa_ d.165.1.1 (A:) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
yerlrlrvthqttgaeyfsfitllrdyvssgsfsnnipllrqstvpvsegqrfvlveltn
aggdsitaaidvtnlyvvayqagdqsyflsdapagaethdftgttrsslpfngsypdler
yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpialaiapgnivtltnvrdviasl
aimlfvcg

SCOPe Domain Coordinates for d3o5wa_:

Click to download the PDB-style file with coordinates for d3o5wa_.
(The format of our PDB-style files is described here.)

Timeline for d3o5wa_: