Lineage for d3svud_ (3svu D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199114Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1199312Protein automated matches [190406] (14 species)
    not a true protein
  7. 1199320Species Artificial gene [TaxId:32630] [189424] (5 PDB entries)
  8. 1199331Domain d3svud_: 3svu D: [196173]
    automated match to d3bx9a_
    mutant

Details for d3svud_

PDB Entry: 3svu (more details), 2.69 Å

PDB Description: Crystal structure of mKate mutant S143C
PDB Compounds: (D:) mkate S143C

SCOPe Domain Sequences for d3svud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3svud_ d.22.1.1 (D:) automated matches {Artificial gene [TaxId: 32630]}
salitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilats
fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki
rgvnfpsngpvmqkktlgweactemlypadgglegrsdmalklvggghlicnlkttyrsk
kpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl

SCOPe Domain Coordinates for d3svud_:

Click to download the PDB-style file with coordinates for d3svud_.
(The format of our PDB-style files is described here.)

Timeline for d3svud_: