Class a: All alpha proteins [46456] (284 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family) the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, (55194) automatically mapped to Pfam PF09236 |
Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein) this is a repeat family; one repeat unit is 1w0a A: found in domain |
Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [109754] (7 PDB entries) Uniprot Q9NZD4 1-94 |
Domain d3ovua_: 3ovu A: [196163] Other proteins in same PDB: d3ovub_, d3ovuc_ automated match to d1xzya_ complexed with hem |
PDB Entry: 3ovu (more details), 2.83 Å
SCOPe Domain Sequences for d3ovua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ovua_ a.7.11.1 (A:) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens) [TaxId: 9606]} lkankdlisaglkefsvllnqqvfndplvseedmvtvvedwmnfyinyyrqqvtgepqer dkalqelrqelntlanpflakyrdflks
Timeline for d3ovua_: