Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
Protein automated matches [190130] (9 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (53 PDB entries) |
Domain d3p5zb_: 3p5z B: [196160] automated match to d3li0a_ complexed with bmp, gol, pol; mutant |
PDB Entry: 3p5z (more details), 1.3 Å
SCOPe Domain Sequences for d3p5zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p5zb_ c.1.2.3 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} dvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcr iiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltem shpgaemfiqgaadeiarmgvdlgvknyvgpssrperlsrlreiigqdsflispgvgaqg gdpgetlrfadaiivgrsiyladnpaaaaagiiesikdll
Timeline for d3p5zb_: