SCOP 1.59: Domain d1buna_: 1bun A:

Lineage for d1buna_ (1bun A:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)

6. Protein beta2-bungarotoxin, phospholipase A2 chain [48641] (1 species)

7. Species Many-banded krait (Bungarus multicinctus), elapid [48642] (1 PDB entry)

8. Domain d1buna_: 1bun A: [19614]
   Other proteins in same PDB: d1bunb_

Details for d1buna_

PDB Entry: 1bun, 2.45 Å

PDB Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action

SCOP Domain Sequences for d1buna_:

Sequence; same for both SEQRES and ATOM records:

>d1buna_ a.133.1.2 (A:) beta2-bungarotoxin, phospholipase A2 chain {Many-banded krait (Bungarus multicinctus), elapid}
nlinfmemirytipcektwgeyadygcycgaggsgrpidaldrccyvhdncygdaekkhk
cnpktqsysykltkrtiicygaagtcarivcdcdrtaalcfgnseyieghknidtarfcq

Timeline for d1buna_:

• d1buna_ first appeared (with stable ids) in SCOP 1.55
  
• d1buna_ appears in SCOP 1.57
  
• d1buna_ appears in SCOP 1.61
  
• d1buna_ appears in the current release, SCOPe 2.08