![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
![]() | Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
![]() | Protein automated matches [190540] (3 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [196132] (1 PDB entry) |
![]() | Domain d3tr7a_: 3tr7 A: [196133] automated match to d2jhqa_ |
PDB Entry: 3tr7 (more details), 2.2 Å
SCOPe Domain Sequences for d3tr7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tr7a_ c.18.1.1 (A:) automated matches {Coxiella burnetii [TaxId: 777]} tqtwqtvlgeekqepyfqeildfvkkerkagkiiyppqkdifnalkltpyeaikvvilgq dpyhgpnqahglafsvrpgvpappslqnifkelhadlgvsipshgflekwakqgvlllna altveagkpqshanigwhrftdkvieslndhpegivfllwgsyaqkksqlitnlrhrilk aphpsplsaargflgcrhfskanqllhemgrgeidwald
Timeline for d3tr7a_: