Lineage for d3tr0a_ (3tr0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849764Species Coxiella burnetii [TaxId:777] [196130] (3 PDB entries)
  8. 1849765Domain d3tr0a_: 3tr0 A: [196131]
    automated match to d2an9a_
    complexed with 5gp, so4

Details for d3tr0a_

PDB Entry: 3tr0 (more details), 1.85 Å

PDB Description: structure of guanylate kinase (gmk) from coxiella burnetii
PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d3tr0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tr0a_ c.37.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
nkanlfiisapsgagktslvralvkalaeikisishttrpkrpgdqegvdyffidetrfq
amvkegaflehatiyerhygtekdwvlrqlkagrdvlleidwqgarqirelfppalsifi
lppsiealrerlikrrqddtaiieqrlalareemahykefdylvvndnfdqavqnlihii
saerlqrdvqekklsrllael

SCOPe Domain Coordinates for d3tr0a_:

Click to download the PDB-style file with coordinates for d3tr0a_.
(The format of our PDB-style files is described here.)

Timeline for d3tr0a_: