Lineage for d3ayya_ (3ayy A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2248943Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2248944Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2249085Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2249086Protein automated matches [191173] (9 species)
    not a true protein
  7. 2249126Species Hydrogenovibrio marinus [TaxId:28885] [196125] (4 PDB entries)
  8. 2249131Domain d3ayya_: 3ayy A: [196127]
    Other proteins in same PDB: d3ayyb_, d3ayyd_
    automated match to d3myrd_
    complexed with 3ni, cmo, cyn, f3s, fe2, gol, mg, o, sf3, sf4

Details for d3ayya_

PDB Entry: 3ayy (more details), 1.32 Å

PDB Description: membrane-bound respiratory [nife] hydrogenase from hydrogenovibrio marinus in a ferricyanide-oxidized condition
PDB Compounds: (A:) Membrane-bound hydrogenase large subunit

SCOPe Domain Sequences for d3ayya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ayya_ e.18.1.0 (A:) automated matches {Hydrogenovibrio marinus [TaxId: 28885]}
svlntpnhykmdnsgrrvvidpvtrieghmrcevnvdennviqnavstgtmwrglevilr
grdprdawafvericgvctgchalasvravedaldikiphnatlireimaktlqihdhiv
hfyhlhaldwvnpvnalkadpqatselqklvsphhpmsspgyfkdiqiriqkfvdsgqlg
ifkngywsnpayklspeadlmavthylealdfqkeivkihaifggknphpnymvggvpca
inidgdmaagapinmerlnfvkslieqgrtfntnvyvpdviaiaafyrdwlyggglsatn
vmdygaypktpydkstdqlpggaiingdwgkihpvdprdpeqvqefvthswykypdetkg
lhpwdgitepnyelgsktkgsrtniieidesakyswiksprwrghavevgplaryilaya
qgveyvktqvhtslnrfnavcrlldpnhkditdlkaflgstigrtlaraleseycgdmml
ddfnqlisnikngdsstantdkwdpsswpehakgvgtvaaprgalahwiviekgkiknyq
cvvpttwngsprdpkgnigafeaslmgtpmerpdepvevlrtlhsfdpclacsth

SCOPe Domain Coordinates for d3ayya_:

Click to download the PDB-style file with coordinates for d3ayya_.
(The format of our PDB-style files is described here.)

Timeline for d3ayya_: