Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Lactococcus lactis [TaxId:416870] [188710] (8 PDB entries) |
Domain d3f8ca_: 3f8c A: [196111] automated match to d3f8ba_ complexed with ht1 |
PDB Entry: 3f8c (more details), 2.2 Å
SCOPe Domain Sequences for d3f8ca_:
Sequence, based on SEQRES records: (download)
>d3f8ca_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]} eipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgi issywgdesqggrrkyyrlteighenmrlafeswsrvdkiienlea
>d3f8ca_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]} eipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgi issywgdegrrkyyrlteighenmrlafeswsrvdkiienlea
Timeline for d3f8ca_: