SCOPe 2.05: Domain d3pt7b_: 3pt7 B:

Lineage for d3pt7b_ (3pt7 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (18 species)
   not a true protein

7. Species Clam (Lucina pectinata) [TaxId:244486] [188300] (7 PDB entries)

8. Domain d3pt7b_: 3pt7 B: [196096]
   automated match to d3pt8a_
   complexed with gol, hem, oxy

Details for d3pt7b_

PDB Entry: 3pt7, 2.15 Å

PDB Description: Structure of HbII-III-Oxy from Lucina pectinata at pH 5.0

PDB Compounds: (B:) Hemoglobin III

SCOPe Domain Sequences for d3pt7b_:

Sequence; same for both SEQRES and ATOM records:

>d3pt7b_ a.1.1.0 (B:) automated matches {Clam (Lucina pectinata) [TaxId: 244486]}
ssgltgpqkaalksswsrfmnnavtngtnfymdlfkaypdtltpfkslfqnvsfnqmtnh
ptmkaqslvfcngmssfvdnlddhevlvvllqkmaklhfnrgirikelrdgygvllryle
dhchvegstknawedfiayicrvqgdfmkerl

Timeline for d3pt7b_:

• d3pt7b_ first appeared in SCOPe 2.02
  
• d3pt7b_ appears in SCOPe 2.04
  
• d3pt7b_ appears in SCOPe 2.06
  
• d3pt7b_ appears in the current release, SCOPe 2.08