Lineage for d4dheb_ (4dhe B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1166517Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1166518Protein automated matches [190123] (28 species)
    not a true protein
  7. 1166527Species Burkholderia thailandensis [TaxId:271848] [196068] (1 PDB entry)
  8. 1166528Domain d4dheb_: 4dhe B: [196069]
    automated match to d1puia_
    complexed with cl

Details for d4dheb_

PDB Entry: 4dhe (more details), 2.2 Å

PDB Description: Crystal structure of a probable GTP-binding protein engB from Burkholderia thailandensis
PDB Compounds: (B:) Probable GTP-binding protein engB

SCOPe Domain Sequences for d4dheb_:

Sequence, based on SEQRES records: (download)

>d4dheb_ c.37.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
gsmafllhqarffttvnhlrdlpptvqpeiafagrsnagkstainvlcnqkrlafasktp
grtqhinyfsvgpaaepvahlvdlpgygyaevpgaakahweqllssylqtrpqlcgmilm
mdarrplteldrrmiewfaptgkpihslltkcdkltrqesinalratqksldayrdagya
gkltvqlfsalkrtglddahalieswlr

Sequence, based on observed residues (ATOM records): (download)

>d4dheb_ c.37.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
gsmafllhqarffttvnhlrdlpptvqpeiafagrsnagkstainvlcnqkrlafahiny
fsvgpaaepvahlvdlpgykahweqllssylqtrpqlcgmilmmdarrplteldrrmiew
faptgkpihslltkcdkltrqesinalratqksldayrdagyagkltvqlfsalkrtgld
dahalieswlr

SCOPe Domain Coordinates for d4dheb_:

Click to download the PDB-style file with coordinates for d4dheb_.
(The format of our PDB-style files is described here.)

Timeline for d4dheb_:

  • d4dheb_ appears in periodic updates to SCOPe 2.02 starting on 2013-05-28
  • d4dheb_ appears in SCOPe 2.03
  • d4dheb_ appears in the current release, SCOPe 2.07, called d4dheb1