Lineage for d4died_ (4die D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850152Species Mycobacterium abscessus [TaxId:561007] [189689] (2 PDB entries)
  8. 1850158Domain d4died_: 4die D: [196067]
    automated match to d3r8ca_
    complexed with c5p, po4

Details for d4died_

PDB Entry: 4die (more details), 2.65 Å

PDB Description: crystal structure of a cytidylate kinase cmk from mycobacterium abscessus bound to cytidine-5'-monophosphate
PDB Compounds: (D:) Cytidylate kinase

SCOPe Domain Sequences for d4died_:

Sequence, based on SEQRES records: (download)

>d4died_ c.37.1.0 (D:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
smvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaat
dqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaess
gavvvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsgggddeyekvladvqrrdh
ldstravsplrpaedalevdtsdmtqeqvvahlldlvrtr

Sequence, based on observed residues (ATOM records): (download)

>d4died_ c.37.1.0 (D:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
smvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaat
dqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaess
gavvvegrdigtvvlpdadvkiyltasaqaraqrvqrrdhldstravsplrpaedalevd
tsdmtqeqvvahlldlvrtr

SCOPe Domain Coordinates for d4died_:

Click to download the PDB-style file with coordinates for d4died_.
(The format of our PDB-style files is described here.)

Timeline for d4died_: