Class a: All alpha proteins [46456] (285 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (24 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [196065] (1 PDB entry) |
Domain d4di0b_: 4di0 B: [196066] automated match to d1j30a_ complexed with edo, fe, gol |
PDB Entry: 4di0 (more details), 1.9 Å
SCOPe Domain Sequences for d4di0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4di0b_ a.25.1.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]} maqlkgskteenlkyafagesqanrrylyfaskadvegqndiaalfrstaegetghahgh leyleavgdpatglpfgtsrqnlqsaiagetheytdmypgmaktardegfeeianwfetl akaershanrytkaldglvd
Timeline for d4di0b_: