Lineage for d3qlqc_ (3qlq C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1118107Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1118111Protein Concanavalin A [49901] (3 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 1118119Species Canavalia virosa [TaxId:28958] [186936] (3 PDB entries)
  8. 1118121Domain d3qlqc_: 3qlq C: [196058]
    automated match to d2a7aa_
    complexed with ca, man, mn

Details for d3qlqc_

PDB Entry: 3qlq (more details), 1.7 Å

PDB Description: crystal structure of concanavalin a bound to an octa-alpha-mannosyl- octasilsesquioxane cluster
PDB Compounds: (C:) Concanavalin-A

SCOPe Domain Sequences for d3qlqc_:

Sequence, based on SEQRES records: (download)

>d3qlqc_ b.29.1.1 (C:) Concanavalin A {Canavalia virosa [TaxId: 28958]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d3qlqc_ b.29.1.1 (C:) Concanavalin A {Canavalia virosa [TaxId: 28958]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
etnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhi
wessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d3qlqc_:

Click to download the PDB-style file with coordinates for d3qlqc_.
(The format of our PDB-style files is described here.)

Timeline for d3qlqc_: