SCOPe 2.07: Domain d3ri7e_: 3ri7 E:

Lineage for d3ri7e_ (3ri7 E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
   corner-like structure formed by two sheets and filled in with 2-3 helices

4. Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family)
   duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold

5. Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
   note: the solution structure determinations disagree in the relative orientations of two motifs

6. Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)

7. Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries)

8. Domain d3ri7e_: 3ri7 E: [196052]
   Other proteins in same PDB: d3ri7a_, d3ri7c_
   automated match to d3dhie_
   complexed with act, fe; mutant

Details for d3ri7e_

PDB Entry: 3ri7, 2.1 Å

PDB Description: Toluene 4 monooxygenase HD Mutant G103L

PDB Compounds: (E:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d3ri7e_:

Sequence; same for both SEQRES and ATOM records:

>d3ri7e_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
tladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrk
tleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

Timeline for d3ri7e_:

• d3ri7e_ first appeared in SCOPe 2.02
  
• d3ri7e_ appears in SCOPe 2.06
  
• d3ri7e_ appears in the current release, SCOPe 2.08