Lineage for d3autb1 (3aut B:1-261)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2842992Species Bacillus megaterium [TaxId:1404] [195340] (5 PDB entries)
  8. 2842996Domain d3autb1: 3aut B:1-261 [196016]
    Other proteins in same PDB: d3auta2, d3autb2
    automated match to d1gcoa_
    complexed with nai

Details for d3autb1

PDB Entry: 3aut (more details), 2 Å

PDB Description: Crystal structure of Bacillus megaterium glucose dehydrogenase 4 in complex with NADH
PDB Compounds: (B:) Glucose 1-dehydrogenase 4

SCOPe Domain Sequences for d3autb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3autb1 c.2.1.2 (B:1-261) automated matches {Bacillus megaterium [TaxId: 1404]}
mytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqai
ivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltga
flgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapkg
irvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyvt
gitlfadggmtkypsfqagrg

SCOPe Domain Coordinates for d3autb1:

Click to download the PDB-style file with coordinates for d3autb1.
(The format of our PDB-style files is described here.)

Timeline for d3autb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3autb2