SCOPe 2.03: Domain d3tb3a_: 3tb3 A:

Lineage for d3tb3a_ (3tb3 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (29 PDB entries)

8. Domain d3tb3a_: 3tb3 A: [195998]
   automated match to d3riia_
   complexed with ca

Details for d3tb3a_

PDB Entry: 3tb3, 2.3 Å

PDB Description: crystal structure of the uch domain of uch-l5 with 6 residues deleted

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase isozyme L5

SCOPe Domain Sequences for d3tb3a_:

Sequence, based on SEQRES records:

>d3tb3a_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyeldglregpi
dlgacnqddwisavrpviekriqkysegeirfnlmaivsd

Sequence, based on observed residues (ATOM records):

>d3tb3a_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarafhfvsyvpvngrlyeldglregpidlgacnqddwisavrp
viekriqkysegeirfnlmaivsd

Timeline for d3tb3a_:

• d3tb3a_ first appeared in SCOPe 2.02
  
• d3tb3a_ appears in SCOPe 2.04
  
• d3tb3a_ appears in the current release, SCOPe 2.08