Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries) |
Domain d3tb3b_: 3tb3 B: [195997] automated match to d3riia_ complexed with ca |
PDB Entry: 3tb3 (more details), 2.3 Å
SCOPe Domain Sequences for d3tb3b_:
Sequence, based on SEQRES records: (download)
>d3tb3b_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk glalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyeldglregpi dlgacnqddwisavrpviekriqkysegeirfnlmaivsd
>d3tb3b_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk glalsnsdvirqvhnsfarafhfvsyvpvngrlyeldglregpidlgacnqddwisavrp viekriqkysegeirfnlmaivsd
Timeline for d3tb3b_: