Lineage for d3qpca_ (3qpc A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178944Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1178945Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1180393Family c.69.1.30: Cutinase-like [52260] (3 proteins)
    minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold
  6. 1180448Protein automated matches [191066] (2 species)
    not a true protein
  7. 1180449Species Fusarium solani [TaxId:169388] [195949] (1 PDB entry)
  8. 1180450Domain d3qpca_: 3qpc A: [195950]
    automated match to d2cuta_

Details for d3qpca_

PDB Entry: 3qpc (more details), 0.98 Å

PDB Description: Structure of Fusarium Solani Cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon
PDB Compounds: (A:) cutinase

SCOPe Domain Sequences for d3qpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qpca_ c.69.1.30 (A:) automated matches {Fusarium solani [TaxId: 169388]}
grttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgg
ayratlgdnalprgtssaairemlglfqqantkcpdatliaggyxqgaalaaasiedlds
airdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpda
rgpapefliekvravrg

SCOPe Domain Coordinates for d3qpca_:

Click to download the PDB-style file with coordinates for d3qpca_.
(The format of our PDB-style files is described here.)

Timeline for d3qpca_: