Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.30: Cutinase-like [52260] (3 proteins) minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold |
Protein automated matches [191066] (2 species) not a true protein |
Species Fusarium solani [TaxId:169388] [195949] (1 PDB entry) |
Domain d3qpca_: 3qpc A: [195950] automated match to d2cuta_ |
PDB Entry: 3qpc (more details), 0.98 Å
SCOPe Domain Sequences for d3qpca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qpca_ c.69.1.30 (A:) automated matches {Fusarium solani [TaxId: 169388]} grttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgg ayratlgdnalprgtssaairemlglfqqantkcpdatliaggyxqgaalaaasiedlds airdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpda rgpapefliekvravrg
Timeline for d3qpca_: