Lineage for d3unfb_ (3unf b:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1224315Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1224316Protein automated matches [190509] (4 species)
    not a true protein
  7. 1224336Species Mus musculus [TaxId:10090] [195930] (1 PDB entry)
  8. 1224337Domain d3unfb_: 3unf b: [195931]
    Other proteins in same PDB: d3unfv_, d3unfy_
    automated match to d1iruh_
    complexed with 04c, cl, iod, k

Details for d3unfb_

PDB Entry: 3unf (more details), 2.9 Å

PDB Description: Mouse 20S immunoproteasome in complex with PR-957
PDB Compounds: (b:) Proteasome subunit beta type-9

SCOPe Domain Sequences for d3unfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unfb_ d.153.1.0 (b:) automated matches {Mus musculus [TaxId: 10090]}
ttimavefdggvvvgsdsrvsagtavvnrvfdklsplhqrifcalsgsaadaqaiadmaa
yqlelhgleleepplvlaaanvvknisykyredllahlivagwdqreggqvygtmggmli
rqpftiggsgssyiygyvdaaykpgmtpeecrrfttnaitlamnrdgssggviylvtita
agvdhrvilgdelpkfyde

SCOPe Domain Coordinates for d3unfb_:

Click to download the PDB-style file with coordinates for d3unfb_.
(The format of our PDB-style files is described here.)

Timeline for d3unfb_: