Lineage for d3unbu_ (3unb U:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1222883Protein Proteasome alpha subunit (non-catalytic) [56255] (6 species)
    contains an extension to the common fold at the N-terminus
  7. 1223224Species Mus musculus [TaxId:10090] [195927] (1 PDB entry)
  8. 1223225Domain d3unbu_: 3unb U: [195928]
    Other proteins in same PDB: d3unbb_, d3unbc_, d3unbm_, d3unbr_, d3unbt_, d3unbv_, d3unbw_, d3unbx_, d3unby_, d3unbz_
    automated match to d1irua_
    complexed with 04c

Details for d3unbu_

PDB Entry: 3unb (more details), 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957
PDB Compounds: (U:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d3unbu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unbu_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Mus musculus [TaxId: 10090]}
srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkll
dsstvthlfkitesigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
sqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflek
kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
lae

SCOPe Domain Coordinates for d3unbu_:

Click to download the PDB-style file with coordinates for d3unbu_.
(The format of our PDB-style files is described here.)

Timeline for d3unbu_: