Lineage for d3unbw_ (3unb W:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2229962Species Mouse (Mus musculus) [TaxId:10090] [195917] (3 PDB entries)
  8. 2230004Domain d3unbw_: 3unb W: [195925]
    Other proteins in same PDB: d3unbe_, d3unbg_, d3unbs_, d3unbu_
    automated match to d1iruj_
    complexed with 04c

Details for d3unbw_

PDB Entry: 3unb (more details), 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957
PDB Compounds: (W:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d3unbw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unbw_ d.153.1.4 (W:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
csldligcpmvtddfvvsgtcseqmygmceslwepnmdpehlfetisqamlnavdrdavs
gmgvivhviekdkittrtlkarmd

SCOPe Domain Coordinates for d3unbw_:

Click to download the PDB-style file with coordinates for d3unbw_.
(The format of our PDB-style files is described here.)

Timeline for d3unbw_: