Lineage for d3unbr_ (3unb R:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (14 species)
    not a true protein
  7. 2554220Species Mouse (Mus musculus) [TaxId:10090] [195917] (3 PDB entries)
  8. 2554259Domain d3unbr_: 3unb R: [195923]
    Other proteins in same PDB: d3unbe_, d3unbg_, d3unbs_, d3unbu_
    automated match to d1irue_
    complexed with 04c

Details for d3unbr_

PDB Entry: 3unb (more details), 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d3unbr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unbr_ d.153.1.4 (R:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
dpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhks
mtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi

SCOPe Domain Coordinates for d3unbr_:

Click to download the PDB-style file with coordinates for d3unbr_.
(The format of our PDB-style files is described here.)

Timeline for d3unbr_: