Class a: All alpha proteins [46456] (284 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
Protein automated matches [190141] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187124] (4 PDB entries) |
Domain d3ux9a_: 3ux9 A: [195916] automated match to d1itfa_ |
PDB Entry: 3ux9 (more details), 2.8 Å
SCOPe Domain Sequences for d3ux9a_:
Sequence, based on SEQRES records: (download)
>d3ux9a_ a.26.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldnrrtlmllaqmsrispssclmdrhdfgfpqeefdgnqfqkapaisvlheliqqifnlf ttkdssaawdedlldkfctelyqqlndleacvmqeervgetplmnadsilavkkyfrrit lyltekkyspcawevvraeimrslslst
>d3ux9a_ a.26.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldnrrtlmllaqmsrispssclmdrhdfgfpqeefdapaisvlheliqqifnlfttkdss aawdedlldkfctelyqqlndleacvmqnadsilavkkyfrritlyltekkyspcawevv raeimrslslst
Timeline for d3ux9a_: