SCOPe 2.06: Domain d3ux9c_: 3ux9 C:

Lineage for d3ux9c_ (3ux9 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein automated matches [190141] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187124] (4 PDB entries)

8. Domain d3ux9c_: 3ux9 C: [195915]
   Other proteins in same PDB: d3ux9b1, d3ux9b2, d3ux9d1, d3ux9d2
   automated match to d1itfa_

Details for d3ux9c_

PDB Entry: 3ux9, 2.8 Å

PDB Description: Structural insights into a human anti-IFN antibody exerting therapeutic potential for systemic lupus erythematosus

PDB Compounds: (C:) Interferon alpha-1/13

SCOPe Domain Sequences for d3ux9c_:

Sequence, based on SEQRES records:

>d3ux9c_ a.26.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldnrrtlmllaqmsrispssclmdrhdfgfpqeefdgnqfqkapaisvlheliqqifnlf
ttkdssaawdedlldkfctelyqqlndleacvmqeervgetplmnadsilavkkyfrrit
lyltekkyspcawevvraeimrslslst

Sequence, based on observed residues (ATOM records):

>d3ux9c_ a.26.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldnrrtlmllaqmsrispssclmdrhdfgfpqeefpaisvlheliqqifnlfttkdssaa
wdedlldkfctelyqqlndleacvmnadsilavkkyfrritlyltekkyspcawevvrae
imrslslst

Timeline for d3ux9c_:

• d3ux9c_ first appeared in SCOPe 2.02
  
• d3ux9c_ appears in SCOPe 2.05
  
• d3ux9c_ appears in SCOPe 2.07
  
• d3ux9c_ appears in the current release, SCOPe 2.08