Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (10 species) |
Species Shewanella benthica [TaxId:43661] [195907] (1 PDB entry) |
Domain d3vmkb_: 3vmk B: [195908] automated match to d1cnza_ complexed with cl, ipm, mg |
PDB Entry: 3vmk (more details), 1.48 Å
SCOPe Domain Sequences for d3vmkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vmkb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Shewanella benthica [TaxId: 43661]} hhhhgssyqiavlagdgigpevmaearkvlaavekrfdlsieyseydvggaaidnhgcpl peatlkgceaadavlfgsvggpkwehlppndqpergallplrghfelfcnmrpaklhpgl ehmsplrsdisekgfdilcvreltggiyfgkpkgrqgegeneeafdtmrysrkeirriak iafesaqgrrkkvtsvdkanvlacsvlwrevveevakdypdvelehiyidnatmqllrrp nefdvmlcsnlfgdivsdeiamltgsmgllasismnsqgfgmyepaggsapdiagqgian pvaqilsaalllrhslkledaalaieaavskalsdgyltcellpasersqakstsqmgdy iaqaiaeg
Timeline for d3vmkb_: