SCOPe 2.06: Domain d4ds7a_: 4ds7 A:

Lineage for d4ds7a_ (4ds7 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Kluyveromyces lactis [TaxId:284590] [195890] (1 PDB entry)

8. Domain d4ds7a_: 4ds7 A: [195893]
   automated match to d1lkja_
   complexed with gol, so4, sr

Details for d4ds7a_

PDB Entry: 4ds7, 2.15 Å

PDB Description: crystal structure of yeast calmodulin bound to the c-terminal fragment of spindle pole body protein spc110

PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d4ds7a_:

Sequence; same for both SEQRES and ATOM records:

>d4ds7a_ a.39.1.5 (A:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
nlteeqiaefkeafalfdkdnsgsisaselatvmrslglspseaevadlmneidvdgnha
iefseflalmsrqlkcndseqelleafkvfdkngdglisaaelkhvltsigekltdaevd
emlrevsdgsgeinikqfaallsk

Timeline for d4ds7a_:

• d4ds7a_ first appeared in SCOPe 2.02
  
• d4ds7a_ appears in SCOPe 2.05
  
• d4ds7a_ appears in SCOPe 2.07
  
• d4ds7a_ appears in the current release, SCOPe 2.08