Lineage for d1bpq__ (1bpq -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) 
Protein Phospholipase A2 [48637] (3 species) Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (19 PDB entries) 
Domain d1bpq__: 1bpq - [19588]
Details for d1bpq__
PDB Entry: 1bpq (more details), 1.8 Å
PDB Description: phospholipase a2 engineering. x-ray structural and functional evidence for the interaction of lysine-56 with substrates
SCOP Domain Sequences for d1bpq__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bpq__ a.133.1.2 (-) Phospholipase A2 {Cow (Bos taurus), pancreas}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqamklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
knc
SCOP Domain Coordinates for d1bpq__:
Click to download the PDB-style file with coordinates for d1bpq__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bpq__:
- d1bpq__ appears in SCOP 1.57
- d1bpq__ appears in the current release, SCOPe 2.08, called d1bpqa_
View in 3D