SCOPe 2.08: Domain d3tnea_: 3tne A:

Lineage for d3tnea_ (3tne A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.0: automated matches [191552] (1 protein)
   not a true family

6. Protein automated matches [190954] (13 species)
   not a true protein

7. Species Candida parapsilosis [TaxId:5480] [188902] (2 PDB entries)

8. Domain d3tnea_: 3tne A: [195873]
   automated match to d3fv3a_
   complexed with rit

Details for d3tnea_

PDB Entry: 3tne, 2.4 Å

PDB Description: The crystal structure of protease Sapp1p from Candida parapsilosis in complex with the HIV protease inhibitor ritonavir

PDB Compounds: (A:) Secreted aspartic protease

SCOPe Domain Sequences for d3tnea_:

Sequence; same for both SEQRES and ATOM records:

>d3tnea_ b.50.1.0 (A:) automated matches {Candida parapsilosis [TaxId: 5480]}
dsislslinegpsyaskvsvgsnkqqqtviidtgssdfwvvdsnaqcgkgvdckssgtft
psssssyknlgaaftirygdgstsqgtwgkdtvtingvsitgqqiadvtqtsvdqgilgi
gytsneavydtsgrqttpnydnvpvtlkkqgkirtnayslylnspsaetgtiifggvdna
kysgklvaeqvtssqaltislasvnlkgssfsfgdgalldsgttltyfpsdfaaqladka
garlvqvardqylyfidcntdtsgttvfnfgngakitvpnteyvyqngdgtclwgiqpsd
dtilgdnflrhayllynldantisiaqvkyttdssisav

Timeline for d3tnea_:

• d3tnea_ first appeared in SCOPe 2.02
  
• d3tnea_ appears in SCOPe 2.07