Lineage for d3rj3b_ (3rj3 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722786Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 2722790Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 2722791Species Human (Homo sapiens) [TaxId:9606] [48253] (19 PDB entries)
  8. 2722799Domain d3rj3b_: 3rj3 B: [195830]
    automated match to d1ghqa_
    complexed with gol; mutant

Details for d3rj3b_

PDB Entry: 3rj3 (more details), 2.35 Å

PDB Description: Complement components factor H CCP19-20 (S1191L mutant) and C3D in complex
PDB Compounds: (B:) complement c3d fragment

SCOPe Domain Sequences for d3rj3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rj3b_ a.102.4.4 (B:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
livtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytqqlafrqp
ssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpdgvfqeda
pvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdfleanymn
lqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsyallallq
lkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapdhqelnldvslqlps

SCOPe Domain Coordinates for d3rj3b_:

Click to download the PDB-style file with coordinates for d3rj3b_.
(The format of our PDB-style files is described here.)

Timeline for d3rj3b_: