SCOPe 2.02: Domain d3swdc_: 3swd C:

Lineage for d3swdc_ (3swd C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.2: EPT/RTPC-like [55205] (3 families)

5. Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
   duplication: 6 repeats of this fold are organized in two RPTC-like domains

6. Protein automated matches [190917] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [195823] (1 PDB entry)

8. Domain d3swdc_: 3swd C: [195829]
   automated match to d1a2na_
   complexed with epz

Details for d3swdc_

PDB Entry: 3swd, 2.5 Å

PDB Description: E. coli MurA in complex with UDP-N-acetylmuramic acid and covalent adduct of PEP with Cys115

PDB Compounds: (C:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3swdc_:

Sequence; same for both SEQRES and ATOM records:

>d3swdc_ d.68.2.2 (C:) automated matches {Escherichia coli [TaxId: 83333]}
mdkfrvqgptklqgevtisgaknaalpilfaallaeepveiqnvpklkdvdtsmkllsql
gakverdgsvhidardvnvfcapydlvktmrasiwalgplvarfgqgqvslpggxtigar
pvdlhisgleqlgatikleegyvkasvdgrlkgahivmdkvsvgatvtimcaatlaegtt
iienaarepeivdtanflitlgakisgqgtdriviegverlgggvyrvlpdrietgtflv
aaaisrgkiicrnaqpdtldavlaklrdagadievgedwisldmhgkrpkavnvrtaphp
afptdmqaqftllnlvaegtgfitetvfenrfmhvpelsrmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkg

Timeline for d3swdc_:

• d3swdc_ is new in SCOPe 2.02-stable
  
• d3swdc_ appears in SCOPe 2.03
  
• d3swdc_ appears in the current release, SCOPe 2.08