SCOPe 2.08: Domain d3tzfa_: 3tzf A:

Lineage for d3tzfa_ (3tzf A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families)

5. Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)

6. Protein automated matches [194480] (7 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [195817] (4 PDB entries)

8. Domain d3tzfa_: 3tzf A: [195819]
   automated match to d1aj2a_
   complexed with 08d, hh2, mg

Details for d3tzfa_

PDB Entry: 3tzf, 2.1 Å

PDB Description: Crystal Structure of the Yersinia pestis Dihydropteroate Synthase with Sulfonamide Drug Complex.

PDB Compounds: (A:) 7,8-dihydropteroate synthase

SCOPe Domain Sequences for d3tzfa_:

Sequence; same for both SEQRES and ATOM records:

>d3tzfa_ c.1.21.1 (A:) automated matches {Yersinia pestis [TaxId: 632]}
mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl
qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn
kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv
acaviaamqgaqiirvhdvketveamciveatrsa

Timeline for d3tzfa_:

• d3tzfa_ first appeared in SCOPe 2.02
  
• d3tzfa_ appears in SCOPe 2.07