Lineage for d3v3zm_ (3v3z M:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255327Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2255328Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2255329Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2255419Protein M (medium) subunit [81481] (4 species)
  7. 2255420Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
    Uniprot P02953
  8. 2255467Domain d3v3zm_: 3v3z M: [195815]
    Other proteins in same PDB: d3v3zh1, d3v3zh2, d3v3zl_
    automated match to d2j8dm_
    complexed with bcl, bph, cl, dio, fe, hto, k, lda, po4, spn, u10; mutant

Details for d3v3zm_

PDB Entry: 3v3z (more details), 2.9 Å

PDB Description: I(L177)H mutant structure of photosynthetic reaction center from Rhodobacter sphaeroides
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d3v3zm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v3zm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqniftqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d3v3zm_:

Click to download the PDB-style file with coordinates for d3v3zm_.
(The format of our PDB-style files is described here.)

Timeline for d3v3zm_: