SCOPe 2.04: Domain d3v3zm_: 3v3z M:

Lineage for d3v3zm_ (3v3z M:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
   Uniprot P02953

8. Domain d3v3zm_: 3v3z M: [195815]
   Other proteins in same PDB: d3v3zh1, d3v3zh2, d3v3zl_
   automated match to d2j8dm_
   complexed with bcl, bph, cl, dio, fe, hto, k, lda, po4, spn, u10; mutant

Details for d3v3zm_

PDB Entry: 3v3z, 2.9 Å

PDB Description: I(L177)H mutant structure of photosynthetic reaction center from Rhodobacter sphaeroides

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d3v3zm_:

Sequence; same for both SEQRES and ATOM records:

>d3v3zm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqniftqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d3v3zm_:

• d3v3zm_ first appeared in SCOPe 2.02
  
• d3v3zm_ appears in SCOPe 2.03
  
• d3v3zm_ appears in SCOPe 2.05
  
• d3v3zm_ appears in the current release, SCOPe 2.08