Lineage for d3v3zl_ (3v3z L:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239027Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1239028Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 1239029Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1239030Protein L (light) subunit [81477] (3 species)
  7. 1239031Species Rhodobacter sphaeroides [TaxId:1063] [81475] (54 PDB entries)
    Uniprot P02954
  8. 1239077Domain d3v3zl_: 3v3z L: [195814]
    Other proteins in same PDB: d3v3zm_
    automated match to d1qovl_
    complexed with bcl, bph, cl, dio, fe, hto, k, lda, po4, spn, u10; mutant

Details for d3v3zl_

PDB Entry: 3v3z (more details), 2.9 Å

PDB Description: I(L177)H mutant structure of photosynthetic reaction center from Rhodobacter sphaeroides
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d3v3zl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v3zl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiahtff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d3v3zl_:

Click to download the PDB-style file with coordinates for d3v3zl_.
(The format of our PDB-style files is described here.)

Timeline for d3v3zl_: