Lineage for d4db5a_ (4db5 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117451Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1117452Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1117453Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1117692Protein automated matches [190204] (3 species)
    not a true protein
  7. 1117719Species Oryctolagus cuniculus [TaxId:9986] [195809] (1 PDB entry)
  8. 1117720Domain d4db5a_: 4db5 A: [195810]
    automated match to d3b93a1
    complexed with b3p

Details for d4db5a_

PDB Entry: 4db5 (more details), 1.52 Å

PDB Description: Crystal structure of Rabbit GITRL
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 18

SCOPe Domain Sequences for d4db5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4db5a_ b.22.1.1 (A:) automated matches {Oryctolagus cuniculus [TaxId: 9986]}
acvakfgplpskwqmeppkpscvnkisdwklkilqnglyiiygqvapdptykgfapfevq
lcknkeaiqtltnnskiqnlggiyefdagdiielrfnsddqvlknntywgivllvtpqfs
s

SCOPe Domain Coordinates for d4db5a_:

Click to download the PDB-style file with coordinates for d4db5a_.
(The format of our PDB-style files is described here.)

Timeline for d4db5a_: