SCOPe 2.06: Domain d4e2ea_: 4e2e A:

Lineage for d4e2ea_ (4e2e A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (42 PDB entries)

8. Domain d4e2ea_: 4e2e A: [195789]
   automated match to d2b05a_
   complexed with edo

Details for d4e2ea_

PDB Entry: 4e2e, 2.25 Å

PDB Description: crystal structure of a tyrosine 3-monooxygenase/tryptophan 5- monooxygenase activation protein, gamma polypeptide (ywhag) from homo sapiens at 2.25 a resolution

PDB Compounds: (A:) 14-3-3 protein gamma

SCOPe Domain Sequences for d4e2ea_:

Sequence; same for both SEQRES and ATOM records:

>d4e2ea_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrssw
rvissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyesk
vfylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnys
vfyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwts

Timeline for d4e2ea_:

• d4e2ea_ first appeared in SCOPe 2.02
  
• d4e2ea_ appears in SCOPe 2.05
  
• d4e2ea_ appears in SCOPe 2.07
  
• d4e2ea_ appears in the current release, SCOPe 2.08