SCOPe 2.02: Domain d3v1la_: 3v1l A:

Lineage for d3v1la_ (3v1l A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
   closely related to the Proline iminopeptidase-like family

6. Protein 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) [53523] (2 species)

7. Species Burkholderia xenovorans [TaxId:36873] [159736] (11 PDB entries)
   Uniprot P47229 4-286

8. Domain d3v1la_: 3v1l A: [195762]
   automated match to d2og1a_
   complexed with mla; mutant

Details for d3v1la_

PDB Entry: 3v1l, 2.11 Å

PDB Description: crystal structure of the s112a/h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400

PDB Compounds: (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase

SCOPe Domain Sequences for d3v1la_:

Sequence; same for both SEQRES and ATOM records:

>d3v1la_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}
ltesstskfvkinekgfsdfnihyneagngetvimlhgggpgaggwsnyyrnvgpfvdag
yrvilkdspgfnksdavvmdeqrglvnaravkglmdaldidrahlvgnamggatalnfal
eypdrigklilmgpgglgpsmfapmpmegikllfklyaepsyetlkqmlqvflydqslit
eellqgrweaiqrqpehlknflisaqkaplstwdvtarlgeikaktfitwgrddrfvpld
hglkllwniddarlhvfskcgqwaqwehadefnrlvidflrha

Timeline for d3v1la_:

• d3v1la_ is new in SCOPe 2.02-stable
  
• d3v1la_ appears in SCOPe 2.03
  
• d3v1la_ appears in the current release, SCOPe 2.08