Lineage for d2ye0a_ (2ye0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940415Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (58 PDB entries)
  8. 2940436Domain d2ye0a_: 2ye0 A: [195755]
    automated match to d3st3a_
    mutant

Details for d2ye0a_

PDB Entry: 2ye0 (more details), 1.47 Å

PDB Description: x-ray structure of the cyan fluorescent protein mturquoise (k206a mutant)
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2ye0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ye0a_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tlxvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
lkgidfkedgnilghkleynyisdnvyitadkqkngikanfkirhniedggvqladhyqq
ntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d2ye0a_:

Click to download the PDB-style file with coordinates for d2ye0a_.
(The format of our PDB-style files is described here.)

Timeline for d2ye0a_: