Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (5 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [195739] (2 PDB entries) |
Domain d4dz3b_: 4dz3 B: [195741] automated match to d1fkla_ complexed with act, ca, edo, fk5; mutant |
PDB Entry: 4dz3 (more details), 2 Å
SCOPe Domain Sequences for d4dz3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dz3b_ d.26.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]} stvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrndpfafvlggg hvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevelldv
Timeline for d4dz3b_: