Lineage for d4dz3b_ (4dz3 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199823Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1199824Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1200027Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1200028Protein automated matches [191162] (5 species)
    not a true protein
  7. 1200029Species Burkholderia pseudomallei [TaxId:320372] [195739] (2 PDB entries)
  8. 1200030Domain d4dz3b_: 4dz3 B: [195741]
    automated match to d1fkla_
    complexed with act, ca, edo, fk5; mutant

Details for d4dz3b_

PDB Entry: 4dz3 (more details), 2 Å

PDB Description: Crystal structure of a Peptidyl-prolyl cis-trans isomerase with surface mutation M61H from Burkholderia pseudomallei complexed with FK506
PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d4dz3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dz3b_ d.26.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
stvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrndpfafvlggg
hvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevelldv

SCOPe Domain Coordinates for d4dz3b_:

Click to download the PDB-style file with coordinates for d4dz3b_.
(The format of our PDB-style files is described here.)

Timeline for d4dz3b_: