Lineage for d4e29a_ (4e29 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207838Superfamily d.58.60: Bacterial polysaccharide co-polymerase-like [160355] (1 family) (S)
    Decorated common fold with extra helical regions, which facilitate oligomerization
  5. 1207839Family d.58.60.1: FepE-like [160356] (4 proteins)
    the ferredoxin-like fold resides mainly on in the N-terminal part that corresponds to Pfam PF02706 (Wzz)
  6. 1207871Protein automated matches [195727] (3 species)
    not a true protein
  7. 1207877Species Shigella flexneri, [TaxId:623] [195731] (2 PDB entries)
  8. 1207878Domain d4e29a_: 4e29 A: [195738]
    automated match to d3b8pa1

Details for d4e29a_

PDB Entry: 4e29 (more details), 1.6 Å

PDB Description: periplasmic domain of the chimeric wzzb chain length regulator protein
PDB Compounds: (A:) Chimeric WzzB chain length determinant protein

SCOPe Domain Sequences for d4e29a_:

Sequence, based on SEQRES records: (download)

>d4e29a_ d.58.60.1 (A:) automated matches {Shigella flexneri, [TaxId: 623]}
kwtstaiitqpdvgqiagynnamnviygqaapkvsdlqetligrfssafsalaetldnqe
epekltiepsvknqqlpltvsyvgqtaegaqmklaqyiqqvddkvnqelerdlkdnialg
rknlqdslrtqevvaqeqkdlrirqieealryadeakitqpqiqqtqdvtqdtmfllgsd
alksmiqneatrplafspayyqtkqtlldiknlkvtadtvhvyryvmkptlpvrrds

Sequence, based on observed residues (ATOM records): (download)

>d4e29a_ d.58.60.1 (A:) automated matches {Shigella flexneri, [TaxId: 623]}
kwtstaiitqpdvgqiagynnamnviygqaapkvsdlqetligrfssafsalaetldnqe
epekltiepsvkpltvsyvgqtaegaqmklaqyiqqvddkvnqelerdlkdnialgrknl
qdslrtqevvaqeqkdlrirqieealryadeakitqpqiqqtqdvtqdtmfllgsdalks
miqneatrplafspayyqtkqtlldiknlkvtadtvhvyryvmkptlpvrrds

SCOPe Domain Coordinates for d4e29a_:

Click to download the PDB-style file with coordinates for d4e29a_.
(The format of our PDB-style files is described here.)

Timeline for d4e29a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4e29b_